PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo20G0036000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 317aa    MW: 33556.4 Da    PI: 7.719
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo20G0036000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-3954113261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      +ek+++cprC+s+ tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Spipo20G0036000  54 PEKIIPCPRCNSMATKFCYYNNYNVNQPRHFCKNCQRYWTAGGSMRNVPVGAGRRKNKHS 113
                      78999*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2851111IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3156112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.49158112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MKESCDDDCP GSGAGIERPA ADLEAAPAKG PEGEEEGDCK IEPPGPEKTA MKKPEKIIPC  60
PRCNSMATKF CYYNNYNVNQ PRHFCKNCQR YWTAGGSMRN VPVGAGRRKN KHSAAAAAAA  120
AAQPTVLRFG SDDPLCDSTR LAEKPHLAAA PSSPHSSGSS VAASNLTEDG GGSHLQEQVL  180
RSSHGSSYPP PPTTWPSPWS ASAAVPVYPT AGFWGWGAAP PWLAAPVLGK HSREAGDAPL  240
KQESSGQIHG DSCRLWVPKT LRIDNPEEAA RSSIWAMAGG FFKPFDHPKD GIRSSASLFH  300
ANPAALSRSL NFQEST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258324.12e-81PREDICTED: cyclic dof factor 2-like
SwissprotQ93ZL52e-62CDF2_ARATH; Cyclic dof factor 2
TrEMBLB9IJZ25e-74B9IJZ2_POPTR; Uncharacterized protein
STRINGPOPTR_0017s12080.11e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.12e-37Dof family protein